PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g451720.1
Common NameMTR_7g451720
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 176aa    MW: 19598.6 Da    PI: 4.5059
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g451720.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.82.1e-07133164537
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtl 37 
                      ++eE+ ll++a  ++G g+W+ +a  +g +++ 
  Medtr7g451720.1 133 SAEEEMLLLEALDMYGFGNWNDVADNIG-TKSN 164
                      68**************************.8886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.846127175IPR017884SANT domain
PfamPF002494.9E-7133166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-4133161IPR009057Homeodomain-like
SuperFamilySSF466898.58E-6133168IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MVVKVEQHVM IIISDTAKEH LSFIDRLDQR LLNFSDETNA TIRADFEASR RLLLASLKTQ  60
EMTFNCLCDG CSTSCCQRCG GTDFQGHVVL PSFARCWNKL LLTCSMCFNQ LCLSITSLMK  120
DNLSFPLICP DSSAEEEMLL LEALDMYGFG NWNDVADNIG TKSNLSVLTT IVLYT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1515211e-157AC151521.2 Medicago truncatula chromosome 7 clone mte1-49d11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013448476.11e-127hypothetical protein MTR_7g451720
TrEMBLA0A072U0501e-127A0A072U050_MEDTR; Uncharacterized protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]